farmersdaughterhotel.comFarmer's Daughter Hotel | Boutique Hotel Los Angeles

farmersdaughterhotel.com Profile

farmersdaughterhotel.com

Title:Farmer's Daughter Hotel | Boutique Hotel Los Angeles

Description:An iconic Los Angeles-based boutique hotel offering residential inspired design in walking distance of CBS, The Grove, LACMA, 3rd Street boutiques & more

Keywords:

Discover farmersdaughterhotel.com website stats, rating, details and status online. Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Find out where is server located. Use our online tools to find owner and admin contact info. Go to regular site

farmersdaughterhotel.com Information

Website / Domain: farmersdaughterhotel.com
Website IP Address: 104.28.1.168
Domain DNS Server: logan.ns.cloudflare.com,anna.ns.cloudflare.com

farmersdaughterhotel.com Rank

Alexa Rank: 2160245
existsite Rank: 3
Google Page Rank: 0/10 (Google Pagerank Has Been Closed)

farmersdaughterhotel.com Traffic & Earnings

Purchase/Sale Value: $6,308
Daily Revenue: $17
Monthly Revenue: $518
Yearly Revenue: $6,308
Daily Unique Visitors: 1,590
Monthly Unique Visitors: 47,700
Yearly Unique Visitors: 580,350

farmersdaughterhotel.com Keywords accounting

Keyword Count Percentage

farmersdaughterhotel.com WebSite Httpheader

StatusCode 200
Transfer-Encoding chunked
Connection keep-alive
Vary Cookie
Cache-Control public, max-age=14400
Content-Type text/html; charset=UTF-8
Server cloudflare-nginx
Date Wed, 21 Feb 2018 07:27:38 GMT

farmersdaughterhotel.com Traffic Sources Chart

farmersdaughterhotel.com Alexa Rank History Chart

farmersdaughterhotel.com aleax

farmersdaughterhotel.com Html To Plain Text

Farmer's Daughter Hotel | Boutique Hotel Los Angeles Home Rooms Experiences Amenities Attractions Gallery Story Contact Tart Little Tart Arrival Date* Departure Date* Rooms and People* 1 Room, 2 Adults1 Room, 1 AdultMore Options Rooms* Adults* Kids Rate* Best Available Rate Farmer's Daughter Hotel | Boutique Hotel Los Angeles Book a Room Arrival Date* Departure Date* Rooms and People* 1 Room, 2 Adults1 Room, 1 AdultMore Options Rooms* Adults* Kids Rate* Best Available Rate A Boutique Los Angeles Hotel offering a unique Experience – friendly, honest, & generous reception, residential & country inspired rooms located walking distance to Museums, Farmers Market, Grove Entertainment Complex, CBS Television city. INFO Front Desk (323) 937-3930 Reservations (800) 334-1658 Address 115 S Fairfax Ave. Los Angeles, CA 90036 Explore Rooms #farmersdaughterhotel social gallery INFO Front Desk (323) 937-3930 Reservations (800) 334-1658 Address 115 S Fairfax Ave. Los Angeles, CA 90036 am am am am Nearby Contact Join our newsletter We'll tell you about great monthly deals * Signup for our monthly newsletter * Share Tweet Stay with us! Home Rooms Experiences Amenities Attractions Gallery Story Contact Tart Little Tart <3 Home Sweet Home Site by Manufactur

farmersdaughterhotel.com Similar Website

Domain WebSite Title
jeffersonsportsmensclub.com Jefferson Sportsmens Club in Jefferson, Wi
ilovelavish.com Home - Lavish Salon
creativejuiz.fr CreativeJuiz - Web Design, HTML5, CSS3, développement PHP/SQL - Geoffrey Crofte
mikedanton22.com Home - Mike Danton Official Website
changefactory.com.au Managing change | Change Factory
albertland.com Albert Land - Search for Properties in Granbury, TX
rockinpaws.com Rockin' Paws
majesticdinnercruise.com Houston dinner cruise, Kemah yachts for Houston weddings, houston party venues
paulscruises.com Paul's Cruises and Travel
imedx.com iMedX | Leader in Health Information & Clinical Documentation
howtorentinnyc.com NYC NO-FEE Landlords & Management Companies, NYC Apartment Rental Reviews | HowToRent In NYC
amwayscam.org Amway Scam - Read This Before Joining
lincolnsmilesdental.com Lincoln Family Dentist, Lincoln Cosmetic Dentist, Lincoln Implant Dentist, Rocklin Dentist
candidafreedom.com Candida Freedom Products Official Website - Probiotic Capsules, Soap, Douche, Lotion, Bath Salts
trilogiadelliosono.it TRILOGIA DELL'IO SONO
pilgrimswaycaravanandcamping.co.uk Home
theuncommonlife.net 釈迦堂生歩の能なしの口叩き日記
creditbox.ru Быстрые займы | Creditbox.ru